PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr039284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 479aa    MW: 53334.7 Da    PI: 8.3372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr039284.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-16124170148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W +eEd+ +++ v+++G ++W+ Ia+ ++ gR +kqc++rw+++l
      Pbr039284.1 124 KGAWIKEEDDCIIKQVEKHGAKRWSVIAKFLP-GRIGKQCRERWHNHL 170
                      799*****************************.*************97 PP

2Myb_DNA-binding50.93.6e-16176218145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT++E+++++ +++++G++ W+ Iar ++ gRt++ +k++w+
      Pbr039284.1 176 RDAWTKDEEQIIAYYHQLYGNK-WAEIARFLP-GRTDNAIKNFWN 218
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.59551118IPR017877Myb-like domain
SuperFamilySSF466893.8E-1155132IPR009057Homeodomain-like
SMARTSM007171.3E-655120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-1658130IPR009057Homeodomain-like
CDDcd001671.30E-858118No hitNo description
PROSITE profilePS5129427.629119174IPR017930Myb domain
SuperFamilySSF466896.79E-29121217IPR009057Homeodomain-like
SMARTSM007177.4E-13123172IPR001005SANT/Myb domain
PfamPF002491.2E-15124170IPR001005SANT/Myb domain
CDDcd001679.91E-14126170No hitNo description
Gene3DG3DSA:1.10.10.609.1E-24131177IPR009057Homeodomain-like
PROSITE profilePS5129416.995175225IPR017930Myb domain
SMARTSM007177.5E-16175223IPR001005SANT/Myb domain
PfamPF002491.1E-13176218IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-20178224IPR009057Homeodomain-like
CDDcd001671.60E-11178221No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MTKINREHPE DAGIGSHEKM GFLFQALYEA EYCSDSPFPK PSSIHWRTTG PTRRSAKSWT  60
AEEDNLLGEL VTKFNRSSWK KIEAGSSFVH EDYFLISAAA CLPGRTDIQC LQRWKKVLNP  120
EVVKGAWIKE EDDCIIKQVE KHGAKRWSVI AKFLPGRIGK QCRERWHNHL CPAINRDAWT  180
KDEEQIIAYY HQLYGNKWAE IARFLPGRTD NAIKNFWNCT LKRKFDSYSP NGCEVDMQSD  240
VLSGEARTDR LEVEEDGQIS DCVVSLNQLT ETEISDNACS TELTLGFSYS HDICSEWKSV  300
KVQKRRSTEG RASSLINPQI ATPFAFMDAS TCTKSNCIPP TRPPCYSTPR SLAQNTSVSS  360
GSPGSRLKNL ALSFKNTPSI IRKKSSRRTD PSNFPDVNSS KACSTLSSTS GGEGTNSKDF  420
ANGKFGSFSF RHRPQTSAAV KSLGRRLERE FDAEKDSGSD QCGHALSAYA SPDVGFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-58592249158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-58592249158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345451.10.0PREDICTED: myb-like protein Q
TrEMBLM5WS751e-171M5WS75_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133012528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.24e-71myb domain protein 3r-4